PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00007.1.g08130.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 780aa    MW: 85788.6 Da    PI: 10.3583
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00007.1.g08130.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.62.9e-28164213251
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                   pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Zjn_sc00007.1.g08130.1.am.mk 164 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 213
                                   8************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-24162213IPR009057Homeodomain-like
SuperFamilySSF466891.02E-12162213IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-20164214IPR006447Myb domain, plants
PfamPF002491.6E-5165213IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 780 aa     Download sequence    Send to blast
MELFPAHPDL QLQISPPVSK PMDLGFWKRA LDSTPVATST PAATAAATTS PSSMAIASPA  60
PTGVGGFHPG AGAVHHQGAL PFVHHTQPIL PGSSGLRDLA SMRPIRGIPV YNASQAPLPF  120
LQSHPHSHQQ HCYDAIVGGV AWSRSPKAAL RLAGAPVKRG ARAPRMRWTT SLHARFVHAV  180
ELLGGHERAT PKSVLELMDV KDLTLAHVKS HLQLSTKHAM HAIKSHTGEE EAAIEFSRKL  240
HGRAGIRHPH HTRTTPQQRG RSIDTHTAQK EMYRTIKTTD HRPASASCYD ISDDNQFDVS  300
NTTSRSESSP QQSNPDNANE HGSSMCALWS NSSMRGAWFQ LDKSSKDAAP SDIKSFEVQL  360
IVAVPSHRDA DQRQKETEPG LQPRTDITHR AVDTSTGPTR KKDGLAGYLW RSNRVVKWLP  420
LPLLLYDLTV VVACTMANTS THAEADRKST RRVDPAIRPM HQPPCYGHRA CTNGRVRAIA  480
RCNEEGGGGG WDADGWTYAP PCTRPAAEGR DQTEMEEEEE KLRHAHAYTE ALGRSALVRA  540
SASFCESASE QARRVRTCPW GRDATAPLAT ARLACFEFAL TLKQKYFIIV FAGPLRSRPG  600
SNSREDTREE RDVSSRQAKT LWDGSSGWRR AEQSRAVSSR ASLWPRSRRL KEACSVGGQW  660
TEIRIRPLRR RSDHTSSYAF ACPPLYASPG TRGPNPLPPP VLSAALPRPF GRIDRLVRRP  720
AFGRWRRRSE GASSFQFLVD SHRSAPRERR GDAAHRLACG IAEMGKGGDL WDDSALVNAF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0691434e-69BT069143.1 Zea mays full-length cDNA clone ZM_BFb0209N04 mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94383445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.17e-34G2-like family protein